Amyloid ß-Protein (Human, 1-38) (0.5 mg vial)
Product overview
- Catalog Number
- PPH08-0121
- Sequence
- Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly
- Target
- Endogenous Form of Amyloid ß-Protein in Cerebrospinal Fluid
- Description
- Amyloidβ protein (Aβ). Aβ is a peptide which consists of 40 or 42 (43) amino acids, and reports show that it is cleaved by β- and γ-secretase from the amyloid precursor protein. It has been shown that many variants of Aβ exist. In 2001, Edward H. Koo et al. found that the secretion of Aβ42 decreased by the effect of nonsteroidal anti-inflammatory drugs (NSAIDs), and with this, the secretion of Aβ38 increased. NSAIDs are attracting attention as a γ- secretase modulation and then Aβ38 and Aβ42 have become important object molecules to be measured as indicators for the effect of NSAIDs. This ELISA kit can measure human Aβ (1-38) which held N terminal side completely. Β-Amyloid peptide that forms cross-β-sheet fibrils of 70-90 Å diameter with similar antigenicity as those found in Alzheimer′s disease. Toxic amyloid beta (1-38) peptide fragment. CAS Number: 131438-74-9. Synthetic. Molecular weight: 4131.58. C184H277N51O56S. DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Category
Product Properties
| Quantity | 1mg |
|---|---|
| Storage | Shipped at 4°C. Store at -20°C for one year. |
| Purity | > 95% |
| Source | Synthetic |
| Forma appearance | Lyophilized powder |
| Price | €162,00 |
- For research use only
- Not for use in diagnostic procedures
€162,00 Tax excluded
Contact us to request price here
Register to buy peptides
Contact us