GLP-2
Product overview
- Catalog Number
- PPH08-0508
- Sequence
- HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Target
- ELISA (EIA) Enzyme-linked Immunosorbent Assay for Antigen Detection. Glucose and GLP-2 (Glucagon-Like Peptide-2) Mobilize Intestinal Triglyceride by Distinct Mechanisms. is used to measure & quantify GLP-2 levels in Metabolism & Endocrine research.
- Description
- Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion._x000D_ _x000D_ When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. Glucagon-Like Peptide 2
Category
Product Properties
| Quantity | 1mg |
|---|---|
| Storage | Shipped at 4°C. Store at -20°C for one year. |
| Purity | > 95% |
| Source | Synthetic |
| Forma appearance | Lyophilized powder |
| Price | €283,00 |
- For research use only
- Not for use in diagnostic procedures
€283,00 Tax excluded
Contact us to request price here
Register to buy peptides
Contact us