APP, A4, AD1 MS Calibrator
Product overview
- Catalog Number
- PPH08-0165
- Sequence
- H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL ^M^VGGV^V^IA-OH
- Target
- High quality, quantitated heavy/light peptide calibrator for Mass Spectroscopy research
- Description
- Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Category
Product Properties
| Quantity | 1mg |
|---|---|
| Storage | Shipped at 4°C. Store at -20°C for one year. |
| Purity | > 95% |
| Source | Synthetic |
| Forma appearance | Lyophilized powder |
| Price | €279.00 |
- For research use only
- Not for use in diagnostic procedures
€279,00 Tax excluded
Contact us to request price here
Register to buy peptides
Contact us