Big Endothelin-1 (Human, 1-38) (0.5 mg vial)
Product overview
- Catalog Number
- PPH08-0197
- Sequence
- Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser
- Target
- Precursor of endothelin
- Description
- Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides. CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11). 120796-97-6. C189H282N48O56S5. WM 4283.1.
Category
Product Properties
| Quantity | 1mg |
|---|---|
| Storage | Shipped at 4°C. Store at -20°C for one year. |
| Purity | > 95% |
| Source | Synthetic |
| Forma appearance | Lyophilized powder |
| Price | €697.00 |
- For research use only
- Not for use in diagnostic procedures
€697,00 Tax excluded
Contact us to request price here
Register to buy peptides
Contact us