Desmin Human Recombinant
Product overview
- Catalog Number
- PPH08-0408
- Sequence
- SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
- Target
- Desmin is a muscle-specific class III intermediate filament.
- Description
- Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies. Desmin is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in this gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.
Category
Product Properties
| Quantity | 50 ug |
|---|---|
| Storage | Shipped at 4°C. Store at -20°C for one year. |
| Purity | > 95% |
| Source | Synthetic |
| Forma appearance | Lyophilized powder |
| Price | €241,00 |
- For research use only
- Not for use in diagnostic procedures
€241,00 Tax excluded
Contact us to request price here
Register to buy peptides
Contact us